PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gh_D02G2302
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family bZIP
Protein Properties Length: 299aa    MW: 33142 Da    PI: 8.0862
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gh_D02G2302genomeNAU-NBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_145.71.4e-14214265455
                  XCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
       bZIP_1   4 lkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkke 55 
                   ++++r++kNRe+A rsR+RK+a++ eLe  v  Le+eN +L+ e  +l+ e
  Gh_D02G2302 214 QQKQKRMIKNRESAARSRERKQAYTVELESMVTHLEEENARLRREECTLQAE 265
                  689****************************************987666655 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003381.7E-10211277IPR004827Basic-leucine zipper domain
PfamPF001702.2E-12213267IPR004827Basic-leucine zipper domain
PROSITE profilePS5021711.484213270IPR004827Basic-leucine zipper domain
CDDcd147074.31E-21215266No hitNo description
SuperFamilySSF579591.5E-10215267No hitNo description
Gene3DG3DSA:1.20.5.1707.7E-14216268No hitNo description
PROSITE patternPS000360218233IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 299 aa     Download sequence    Send to blast
MASSKVITTT SQTNPDVTRQ PSLCSSLSTL FADLQNQQNN NENRSQNCFG SMSMDDLLKN  60
IYPSTPPPPP STTGNTGSDA HHAQFLGGSI SREGSFSLPK DVASKSVDEV WKEIVAGGGD  120
QRQEGQLEEM TLEDFLTKAG AVREEDVSRG VVNQVSAGVF HVEPAVIYGG GSQFSTFGNN  180
GGVDHQRLVV VPAGGGGRGK RRAVEEPPLD KATQQKQKRM IKNRESAARS RERKQAYTVE  240
LESMVTHLEE ENARLRREEC TLQAELNKER FKQLMEKLVP VDEKQRPRRV IRRARSMEW
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Ghi.197460.0boll| ovule
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012480546.11e-176PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like protein 5
TrEMBLA0A0D2SNJ70.0A0A0D2SNJ7_G
STRINGVIT_12s0055g00420.t011e-86(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM16538611
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G44080.15e-30bZIP family protein